General Information

  • ID:  hor004056
  • Uniprot ID:  P09971
  • Protein name:  Gamma-SG neuropeptide
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  Expression is restricted to the subesophageal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016084 myostimulatory hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TMSFSPRL
  • Length:  8
  • Propeptide:  MYKTNIVFNVLALALFSIFFASCTDMKDESDRGAHSERGALWFGPRLGKRSMKPSTEDNRQTFLRLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRSVAKPQTHESLEFIPRLGRRLSEDMPATPADQEMYQPDPEEMESRTRYFSPRLGRTMSFSPRLGRELSYDYPTKYRVARSVNKTMDN
  • Signal peptide:  MYKTNIVFNVLALALFSIFFASC
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induce diapause egg
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09971-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004056_AF2.pdbhor004056_ESM.pdb

Physical Information

Mass: 106313 Formula: C41H67N11O12S
Absent amino acids: ACDEGHIKNQVWY Common amino acids: S
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: 1.25 Boman Index: -1404
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 10917.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8475067
  • Title:  Precursor Polyprotein for Multiple Neuropeptides Secreted From the Suboesophageal Ganglion of the Silkworm Bombyx Mori: Characterization of the cDNA Encoding the Diapause Hormone Precursor and Identification of Additional Peptides